PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN31558.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family bHLH
Protein Properties Length: 246aa    MW: 28268 Da    PI: 8.4948
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN31558.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH37.83.5e-1274126155
                 CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
         HLH   1 rrrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 
                 +++ h e+Er+RR+++ + ++ Lr+llP  +   ++K s ++   +A +YIk++q
  KHN31558.1  74 KKMIHMEIERKRRQEMATFYASLRSLLPLEF--IKGKRSISDHMNEAANYIKHMQ 126
                 577899***********************65..*********************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474592.36E-1372144IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000834.15E-973130No hitNo description
PROSITE profilePS5088812.96373125IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000102.1E-975126IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.106.5E-1075145IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003536.8E-579131IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MLPLQRGNEL VIQFSNSPHH QQHKISEDLI LDDYASLNVN DSNQKFITSS SSQPTKKLFY  60
GANKKNHDSN EHKKKMIHME IERKRRQEMA TFYASLRSLL PLEFIKGKRS ISDHMNEAAN  120
YIKHMQNNIK ELGAKRDEMK KLSNHCNNME NNHAGLHTSC NFTIHENNGI MGIEITSGFR  180
EEKPKISKLL QFLTEEGFEV VSCFSTEVNG RLLHSVQCEV NNSNSVDLSE LRKKVSNAFP  240
TFRCSD
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18186ERKRRQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003548234.10.0PREDICTED: transcription factor bHLH118-like
TrEMBLA0A0B2RHW10.0A0A0B2RHW1_GLYSO; Transcription factor bHLH126
TrEMBLI1MQ590.0I1MQ59_SOYBN; Uncharacterized protein
STRINGGLYMA16G32620.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF79233125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25410.13e-39bHLH family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]